United States
Germany
Japan
United Kingdom
China
Tropomyosin 3 (TPM3) (NM_001043353) Human Recombinant Protein
CAT＃: TP320212
Purified recombinant protein of Homo sapiens tropomyosin 3 (TPM3), transcript variant 5, 20 µg
View other "Tropomyosin 3" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220212 representing NM_001043353
Red=Cloning site Green=Tags(s) MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERL ATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDL ERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSV AKLEKTIDDLEERLYSQLERNRLLSNELKLTLHDLCD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001036818 |
| Locus ID | 7170 |
| UniProt ID | P06753 |
| Refseq Size | 4539 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 741 |
| Synonyms | CAPM1; CFTD; HEL-189; HEL-S-82p; hscp30; NEM1; OK/SW-cl.5; TM-5; TM3; TM5; TM30; TM30nm; TPM3nu; TPMsk3; TRK |
| Summary | This gene encodes a member of the tropomyosin family of actin-binding proteins. Tropomyosins are dimers of coiled-coil proteins that provide stability to actin filaments and regulate access of other actin-binding proteins. Mutations in this gene result in autosomal dominant nemaline myopathy and other muscle disorders. This locus is involved in translocations with other loci, including anaplastic lymphoma receptor tyrosine kinase (ALK) and neurotrophic tyrosine kinase receptor type 1 (NTRK1), which result in the formation of fusion proteins that act as oncogenes. There are numerous pseudogenes for this gene on different chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Thyroid cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407004 | TPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407686 | TPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420816 | TPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420818 | TPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407004 | Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 2 |
CNY 3,080.00 |
|
| LY407686 | Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 1 |
CNY 3,080.00 |
|
| LY420816 | Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 4 |
CNY 3,080.00 |
|
| LY420818 | Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 5 |
CNY 3,080.00 |
|
| PH303276 | TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_689476) |
CNY 19,520.00 |
|
| PH309904 | TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_705935) |
CNY 19,520.00 |
|
| PH316840 | TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_001036816) |
CNY 19,520.00 |
|
| PH320212 | TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_001036818) |
CNY 14,250.00 |
|
| TP303276 | Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP309904 | Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP316840 | Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP720883 | Purified recombinant protein of Human tropomyosin 3 (TPM3), transcript variant 1 |
CNY 1,800.00 |
其它Tropomyosin 3产品
