FHL2 (NM_201555) Human Recombinant Protein
CAT#: TP320395
Recombinant protein of human four and a half LIM domains 2 (FHL2), transcript variant 2, 20 µg
View other "FHL2" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220395 protein sequence
Red=Cloning site Green=Tags(s) MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_963849 |
Locus ID | 2274 |
UniProt ID | Q14192 |
Refseq Size | 1907 |
Cytogenetics | 2q12.2 |
Refseq ORF | 837 |
Synonyms | AAG11; DRAL; FHL-2; SLIM-3; SLIM3 |
Summary | This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404459 | FHL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404460 | FHL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419930 | FHL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422060 | FHL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404459 | Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 2 |
CNY 3,080.00 |
|
LY404460 | Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 4 |
CNY 3,080.00 |
|
LY419930 | Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 1 |
CNY 3,080.00 |
|
LY422060 | Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 5 |
CNY 3,080.00 |
|
PH300398 | FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_963851) |
CNY 14,250.00 |
|
PH319762 | FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001034581) |
CNY 14,250.00 |
|
PH320344 | FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001441) |
CNY 14,250.00 |
|
PH320395 | FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_963849) |
CNY 19,520.00 |
|
TP300398 | Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP319762 | Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP320344 | Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760738 | Purified recombinant protein of Human four and a half LIM domains 2 (FHL2), transcript variant 5, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |