FLCN (NM_144997) Human Recombinant Protein
CAT#: TP320396
Recombinant protein of human folliculin (FLCN), transcript variant 1, 20 µg
View other "FLCN" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220396 representing NM_144997
Red=Cloning site Green=Tags(s) MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRAHSPAEGASVE SSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGP IFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRIYLINSWPFLLGKVRGIIDELQGKALKVFEA EQFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTE DTLVQMEKLADLEEESESWDNSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLR HMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL SPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAAL TNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKT YKSHLMSTVRSPTASESRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 64.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659434 |
Locus ID | 201163 |
UniProt ID | Q8NFG4 |
Refseq Size | 3717 |
Cytogenetics | 17p11.2 |
Refseq ORF | 1737 |
Synonyms | BHD; DENND8B; FLCL |
Summary | This gene is located within the Smith-Magenis syndrome region on chromosome 17. Mutations in this gene are associated with Birt-Hogg-Dube syndrome, which is characterized by fibrofolliculomas, renal tumors, lung cysts, and pneumothorax. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403410 | FLCN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408135 | FLCN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY403410 | Transient overexpression lysate of folliculin (FLCN), transcript variant 2 |
CNY 3,080.00 |
|
LY408135 | Transient overexpression lysate of folliculin (FLCN), transcript variant 1 |
CNY 4,840.00 |
|
PH320396 | FLCN MS Standard C13 and N15-labeled recombinant protein (NP_659434) |
CNY 19,520.00 |
|
TP761774 | Purified recombinant protein of Human folliculin (FLCN), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |