United States
Germany
Japan
United Kingdom
China
SEC23B (NM_032986) Human Recombinant Protein
CAT＃: TP320880
Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 3, 20 µg
View other "SEC23B" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220880 representing NM_032986
Red=Cloning site Green=Tags(s) MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAVL NPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLYVVDTCLE EDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPA MPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGT FPNTGARIMLFTGGPPTQGPGMVVGDELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIY ACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKDFNGDFRMAFGATLDVKTSRELKIAG AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNTPIPQGGRGAIQFVTHYQHS STQRRIRVTTIARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEEGPDVLRWLDRQLIRLCQKFG QYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPILYSYSF HGPPEPVLLDSSSILADRILLMDTFFQIVIYLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQA RFPMPRYINTEHGGSQARFLLSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 86.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116781 |
| Locus ID | 10483 |
| UniProt ID | Q15437 |
| Refseq Size | 3126 |
| Cytogenetics | 20p11.23 |
| Refseq ORF | 2301 |
| Synonyms | CDA-II; CDAII; CDAN2; CWS7; HEMPAS; hSec23B |
| Summary | The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants have been identified in this gene. [provided by RefSeq, Feb 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403219 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409758 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416692 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403219 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 2 |
CNY 3,080.00 |
|
| LY409758 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 3 |
CNY 3,080.00 |
|
| LY416692 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1 |
CNY 3,080.00 |
|
| PH310572 | SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_116780) |
CNY 19,520.00 |
|
| PH317911 | SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_006354) |
CNY 19,520.00 |
|
| PH320880 | SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_116781) |
CNY 19,520.00 |
|
| TP310572 | Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP317911 | Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1, 20 µg |
CNY 2,900.00 |
