United States
Germany
Japan
United Kingdom
China
TBX3 (NM_005996) Human Recombinant Protein
CAT＃: TP320990
Recombinant protein of human T-box 3 (TBX3), transcript variant 1, 20 µg
View other "TBX3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220990 representing NM_005996
Red=Cloning site Green=Tags(s) MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVG AAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRC SGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLT NNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA KGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCP SEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDKASPDSRHSPA TISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFAPLTVQTDAAAAHLAQGPLPGLGFAPGLAGQ QFFNGHPLFLHPSQFAMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTAMASAAAAQGLSGASAATLPF HLQQHVLASQGLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIPVPVP DGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSE LQSIQRLVSGLEAKPDRSRSASP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 77 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005987 |
| Locus ID | 6926 |
| UniProt ID | O15119 |
| Refseq Size | 4754 |
| Cytogenetics | 12q24.21 |
| Refseq ORF | 2169 |
| Synonyms | TBX3-ISO; UMS; XHL |
| Summary | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413892 | TBX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416941 | TBX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC429275 | TBX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY413892 | Transient overexpression lysate of T-box 3 (TBX3), transcript variant 2 |
CNY 3,080.00 |
|
| LY416941 | Transient overexpression lysate of T-box 3 (TBX3), transcript variant 1 |
CNY 4,840.00 |
|
| PH306829 | TBX3 MS Standard C13 and N15-labeled recombinant protein (NP_057653) |
CNY 19,520.00 |
|
| PH320990 | TBX3 MS Standard C13 and N15-labeled recombinant protein (NP_005987) |
CNY 19,520.00 |
|
| TP306829 | Recombinant protein of human T-box 3 (TBX3), transcript variant 2, 20 µg |
CNY 2,900.00 |
