Protein Kinase D2 (PRKD2) (NM_001079881) Human Recombinant Protein
CAT#: TP321498
Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 3, 20 µg
View other "Protein Kinase D2" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221498 representing NM_001079881
Red=Cloning site Green=Tags(s) MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 96.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001073350 |
Locus ID | 25865 |
UniProt ID | Q9BZL6 |
Refseq Size | 3202 |
Cytogenetics | 19q13.32 |
Refseq ORF | 2634 |
Synonyms | HSPC187; nPKC-D2; PKD2 |
Summary | The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It can bind to diacylglycerol (DAG) in the trans-Golgi network (TGN) and may regulate basolateral membrane protein exit from TGN. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402555 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421574 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421575 | PRKD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402555 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 1 |
CNY 4,840.00 |
|
LY421574 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 2 |
CNY 4,840.00 |
|
LY421575 | Transient overexpression lysate of protein kinase D2 (PRKD2), transcript variant 3 |
CNY 4,840.00 |
|
PH315335 | PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_057541) |
CNY 19,520.00 |
|
PH321442 | PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073349) |
CNY 14,250.00 |
|
PH321498 | PRKD2 MS Standard C13 and N15-labeled recombinant protein (NP_001073350) |
CNY 19,520.00 |
|
TP315335 | Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP321442 | Recombinant protein of human protein kinase D2 (PRKD2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Protein Kinase D2产品