United States
Germany
Japan
United Kingdom
China
PANK1 (NM_148977) Human Recombinant Protein
CAT＃: TP321538
Recombinant protein of human pantothenate kinase 1 (PANK1), transcript variant alpha, 20 µg
View other "PANK1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221538 representing NM_148977
Red=Cloning site Green=Tags(s) MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAGVLQAGAVGPA RGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDLQRGRLSRGPRTAPPAPGMGD RSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPPHVCSRGPVGGSDAAPQRLPLLPELQPQPLL PQHDSPAKKCRLRRRMDSGRKNRPPFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSN TAYGKTGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDF RMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQG SAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLA YAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 64.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_683878 |
| Locus ID | 53354 |
| UniProt ID | Q8TE04 |
| Refseq Size | 3367 |
| Cytogenetics | 10q23.31 |
| Refseq ORF | 1794 |
| Synonyms | PANK |
| Summary | This gene encodes a member of the pantothenate kinase family. Pantothenate kinases are key regulatory enzymes in the biosynthesis of coenzyme A (CoA). The encoded protein catalyzes the first and rate-limiting enzymatic reaction in CoA biosynthesis and is regulated by CoA through feedback inhibition. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. This gene and an intronic miRNA on the same strand are co-regulated by the tumor suppressor p53 (see PMID 20833636). [provided by RefSeq, Apr 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407715 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407716 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408718 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407715 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant alpha |
CNY 4,840.00 |
|
| LY407716 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant beta |
CNY 3,080.00 |
|
| LY408718 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant gamma |
CNY 3,080.00 |
|
| PH321519 | PANK1 MS Standard C13 and N15-labeled recombinant protein (NP_612189) |
CNY 19,520.00 |
|
| PH321538 | PANK1 MS Standard C13 and N15-labeled recombinant protein (NP_683878) |
CNY 14,250.00 |
|
| TP321519 | Recombinant protein of human pantothenate kinase 1 (PANK1), transcript variant gamma, 20 µg |
CNY 2,900.00 |
