DEFB118 (NM_054112) Human Recombinant Protein
CAT#: TP321558
Recombinant protein of human defensin, beta 118 (DEFB118), 20 µg
View other "DEFB118" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221558 protein sequence
Red=Cloning site Green=Tags(s) MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSP TPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_473453 |
Locus ID | 117285 |
UniProt ID | Q96PH6, A0A384MTK2 |
Refseq Size | 1158 |
Cytogenetics | 20q11.21 |
Refseq ORF | 369 |
Synonyms | C20orf63; DEFB-18; ESC42; ESP13.6 |
Summary | This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. Expression of this gene is regulated by androgen, and the encoded protein binds to sperm and exhibits antibacterial activity against E. coli. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409287 | DEFB118 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409287 | Transient overexpression lysate of defensin, beta 118 (DEFB118) |
CNY 3,080.00 |
|
PH321558 | DEFB118 MS Standard C13 and N15-labeled recombinant protein (NP_473453) |
CNY 19,520.00 |
其它DEFB118产品