SRP9 (NM_003133) Human Recombinant Protein
CAT#: TP321573
Recombinant protein of human signal recognition particle 9kDa (SRP9), transcript variant 2, 20 µg
View other "SRP9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221573 protein sequence
Red=Cloning site Green=Tags(s) MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLM RLMVAKEARNVTMETE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003124 |
Locus ID | 6726 |
UniProt ID | P49458 |
Refseq Size | 1524 |
Cytogenetics | 1q42.12 |
Refseq ORF | 258 |
Synonyms | ALURBP |
Summary | Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Protein export |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418876 | SRP9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418876 | Transient overexpression lysate of signal recognition particle 9kDa (SRP9), transcript variant 2 |
CNY 3,080.00 |
|
PH321573 | SRP9 MS Standard C13 and N15-labeled recombinant protein (NP_003124) |
CNY 19,520.00 |