United States
Germany
Japan
United Kingdom
China
DUT (NM_001948) Human Recombinant Protein
CAT＃: TP321635
Recombinant protein of human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
热销推荐CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221635 representing NM_001948
Red=Cloning site Green=Tags(s) MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDI QIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYP EIEEVQALDDTERGSGGFGSTGKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001939 |
| Locus ID | 1854 |
| UniProt ID | P33316 |
| Refseq Size | 1874 |
| Cytogenetics | 15q21.1 |
| Refseq ORF | 492 |
| Synonyms | dUTPase |
| Summary | This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400715 | DUT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422498 | DUT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400715 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
| LY422498 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
| PH310600 | DUT MS Standard C13 and N15-labeled recombinant protein (NP_001020420) |
CNY 14,250.00 |
|
| PH321635 | DUT MS Standard C13 and N15-labeled recombinant protein (NP_001939) |
CNY 14,250.00 |
|
| TP310600 | Purified recombinant protein of Homo sapiens deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP720892 | Purified recombinant protein of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,140.00 |
