RCC1 (NM_001269) Human Recombinant Protein
CAT#: TP321798
Recombinant protein of human regulator of chromosome condensation 1 (RCC1), transcript variant 3, 20 µg
View other "RCC1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221798 protein sequence
Red=Cloning site Green=Tags(s) MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVV QAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRV FLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPEL FANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESC FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSV ACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ S myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001260 |
Locus ID | 1104 |
UniProt ID | P18754, Q5T081 |
Refseq Size | 2540 |
Cytogenetics | 1p35.3 |
Refseq ORF | 1263 |
Synonyms | CHC1; RCC1-I; SNHG3-RCC1 |
Summary | Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis (PubMed:1944575, PubMed:17435751, PubMed:20668449, PubMed:22215983, PubMed:11336674). Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis (PubMed:12194828, PubMed:17435751, PubMed:22215983). Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import (PubMed:22215983). Involved in the regulation of onset of chromosome condensation in the S phase (PubMed:3678831). Binds both to the nucleosomes and double-stranded DNA (PubMed:17435751, PubMed:18762580).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420036 | RCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420775 | RCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420778 | RCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420036 | Transient overexpression lysate of regulator of chromosome condensation 1 (RCC1), transcript variant 3 |
CNY 4,840.00 |
|
LY420775 | Transient overexpression lysate of regulator of chromosome condensation 1 (RCC1), transcript variant 2 |
CNY 4,840.00 |
|
LY420778 | Transient overexpression lysate of SNHG3-RCC1 readthrough transcript (SNHG3-RCC1), transcript variant 1 |
CNY 3,080.00 |
|
PH303556 | SNHG3 MS Standard C13 and N15-labeled recombinant protein (NP_001041664) |
CNY 19,520.00 |
|
PH321798 | RCC1 MS Standard C13 and N15-labeled recombinant protein (NP_001260) |
CNY 19,520.00 |
|
TP303556 | Recombinant protein of human SNHG3-RCC1 readthrough transcript (SNHG3-RCC1), transcript variant 3, 20 µg |
CNY 2,900.00 |