United States
Germany
Japan
United Kingdom
China
CUG BP1 (CELF1) (NM_198700) Human Recombinant Protein
CAT＃: TP321943
Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2, 20 µg
View other "CUG BP1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221943 protein sequence
Red=Cloning site Green=Tags(s) MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRK AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRIL RGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISA ASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNAL TTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTG STMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMP FGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_941989 |
| Locus ID | 10658 |
| UniProt ID | Q92879 |
| Refseq Size | 4656 |
| Cytogenetics | 11p11.2 |
| Refseq ORF | 1449 |
| Synonyms | BRUNOL2; CUG-BP; CUGBP; CUGBP1; EDEN-BP; hNab50; NAB50; NAPOR |
| Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401964 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404819 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422453 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC433163 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433208 | CELF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401964 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1 |
CNY 3,080.00 |
|
| LY404819 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 2 |
CNY 4,840.00 |
|
| LY422453 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 3 |
CNY 4,840.00 |
|
| LY433163 | Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 5 |
CNY 3,080.00 |
|
| LY433208 | Transient overexpression lysate of CUGBP, Elav-like family member 1 (CELF1), transcript variant 4 |
CNY 3,080.00 |
|
| PH306275 | CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_006551) |
CNY 19,520.00 |
|
| PH321943 | CELF1 MS Standard C13 and N15-labeled recombinant protein (NP_941989) |
CNY 19,520.00 |
|
| TP306275 | Recombinant protein of human CUG triplet repeat, RNA binding protein 1 (CUGBP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它CUG BP1产品
