ANKS1B (NM_020140) Human Recombinant Protein
CAT#: TP322572
Recombinant protein of human ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 3, 20 µg
View other "ANKS1B" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222572 representing NM_020140
Red=Cloning site Green=Tags(s) MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGS NVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGDYTKAFLINGYTSMD LLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLRTGDWGEPSITLRPPNEATASTP VQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGV KFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEV AYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064525 |
Locus ID | 56899 |
UniProt ID | Q7Z6G8 |
Refseq Size | 1714 |
Cytogenetics | 12q23.1 |
Refseq ORF | 1242 |
Synonyms | AIDA; AIDA-1; ANKS2; cajalin-2; EB-1; EB1 |
Summary | This gene encodes a multi-domain protein that is predominantly expressed in brain and testis. This protein interacts with amyloid beta protein precursor (AbetaPP) and may have a role in normal brain development, and in the pathogenesis of Alzheimer's disease. Expression of this gene has been shown to be elevated in patients with pre-B cell acute lymphocytic leukemia associated with t(1;19) translocation. Alternatively spliced transcript variants encoding different isoforms (some with different subcellular localization, PMID:15004329) have been described for this gene. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405556 | ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC407279 | ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC412629 | ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405556 | Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 2 |
CNY 4,840.00 |
|
LY407279 | Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 1 |
CNY 4,840.00 |
|
LY412629 | Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 3 |
CNY 3,080.00 |
|
PH322572 | ANKS1B MS Standard C13 and N15-labeled recombinant protein (NP_064525) |
CNY 19,520.00 |