United States
Germany
Japan
United Kingdom
China
MBNL1 (NM_207297) Human Recombinant Protein
CAT＃: TP323199
Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 7, 20 µg
View other "MBNL1" proteins (23)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223199 representing NM_207297
Red=Cloning site Green=Tags(s) MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLH PPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPV SPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTM IDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLP KRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVDTHNICRTSD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_997180 |
| Locus ID | 4154 |
| UniProt ID | Q9NR56 |
| Refseq Size | 5277 |
| Cytogenetics | 3q25.1-q25.2 |
| Refseq ORF | 1026 |
| Synonyms | EXP; MBNL |
| Summary | This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities. [provided by RefSeq, Sep 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402822 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404075 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404076 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404077 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404078 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404079 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404080 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402822 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 1 |
CNY 3,080.00 |
|
| LY404075 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 2 |
CNY 3,080.00 |
|
| LY404076 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 3 |
CNY 3,080.00 |
|
| LY404077 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 4 |
CNY 3,080.00 |
|
| LY404078 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 5 |
CNY 3,080.00 |
|
| LY404079 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 6 |
CNY 3,080.00 |
|
| LY404080 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 7 |
CNY 3,080.00 |
|
| PH308112 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_066368) |
CNY 19,520.00 |
|
| PH319704 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997178) |
CNY 14,250.00 |
|
| PH323104 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997176) |
CNY 14,250.00 |
|
| PH323199 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997180) |
CNY 14,250.00 |
|
| PH323216 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997179) |
CNY 19,520.00 |
|
| TP308112 | Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP319704 | Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP323104 | Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP323216 | Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 6, 20 µg |
CNY 2,900.00 |
