RNF14 (NM_004290) Human Recombinant Protein
CAT#: TP323304
Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 1, 20 µg
View other "RNF14" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223304 representing NM_004290
Red=Cloning site Green=Tags(s) MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFL PPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNI VSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQI KCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVK ELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPC KVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKM TCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004281 |
Locus ID | 9604 |
UniProt ID | Q9UBS8 |
Refseq Size | 4395 |
Cytogenetics | 5q31.3 |
Refseq ORF | 1422 |
Synonyms | ARA54; HFB30; HRIHFB2038; TRIAD2 |
Summary | The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405271 | RNF14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY405271 | Transient overexpression lysate of ring finger protein 14 (RNF14), transcript variant 4 |
CNY 4,840.00 |
|
PH323304 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_004281) |
CNY 14,250.00 |
|
PH323362 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899647) |
CNY 19,520.00 |
|
PH323420 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899648) |
CNY 14,250.00 |
|
PH323491 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899646) |
CNY 14,250.00 |
|
TP323362 | Recombinant protein of human ring finger protein 14 (RNF14), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP323420 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP323491 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 3, 20 µg |
CNY 2,900.00 |