Keratinocyte differentiation associated protein (KRTDAP) (NM_207392) Human Recombinant Protein
CAT#: TP323306L
Recombinant protein of human keratinocyte differentiation-associated protein (KRTDAP), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223306 protein sequence
Red=Cloning site Green=Tags(s) MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALF ESIKRKLPFLNWDAFPKLKGLRSATPDAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997275 |
Locus ID | 388533 |
UniProt ID | P60985 |
Refseq Size | 500 |
Cytogenetics | 19q13.12 |
Refseq ORF | 297 |
Synonyms | KDAP; UNQ467 |
Summary | This gene encodes a protein which may function in the regulation of keratinocyte differentiation and maintenance of stratified epithelia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
其它Keratinocyte differentiation associated protein产品