NOXO1 (NM_172168) Human Recombinant Protein
CAT#: TP323385
Purified recombinant protein of Homo sapiens NADPH oxidase organizer 1 (NOXO1), transcript variant c, 20 µg
View other "NOXO1" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223385 representing NM_172168
Red=Cloning site Green=Tags(s) MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKKTLKETFPVEAGLLRRSDRVL PKLLGQASLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAPQPLDLEPALPPGSR VILPTPEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR QTAWFPAPYLEEAAPGQGREGGPSLGSSGPQFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYG DRAGLLPAVLLRPEGLGALLSGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRR ALERRPRRQGRPRGCVDSVPHPTTEQ SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 41.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_751908 |
Locus ID | 124056 |
UniProt ID | Q8NFA2, A8K832 |
Refseq Size | 1147 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1128 |
Synonyms | P41NOX; P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28 |
Summary | This gene encodes an NADPH oxidase (NOX) organizer, which positively regulates NOX1 and NOX3. The protein contains a PX domain and two SH3 domains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403398 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406778 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406779 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430349 | NOXO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403398 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant a |
CNY 3,080.00 |
|
LY406778 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant b |
CNY 3,080.00 |
|
LY406779 | Transient overexpression lysate of NADPH oxidase organizer 1 (NOXO1), transcript variant c |
CNY 3,080.00 |
|
PH314973 | NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751907) |
CNY 19,520.00 |
|
PH323385 | NOXO1 MS Standard C13 and N15-labeled recombinant protein (NP_751908) |
CNY 14,250.00 |
|
TP314973 | Recombinant protein of human NADPH oxidase organizer 1 (NOXO1), transcript variant b, 20 µg |
CNY 2,900.00 |
|
TP761645 | Purified recombinant protein of Human NADPH oxidase organizer 1 (NOXO1), transcript variant a, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |