Placental lactogen (CSH2) (NM_022645) Human Recombinant Protein
CAT#: TP323392
Recombinant protein of human chorionic somatomammotropin hormone 2 (CSH2), transcript variant 3, 20 µg
View other "Placental lactogen" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223392 representing NM_022645
Red=Cloning site Green=Tags(s) MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQIL KQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_072171 |
Locus ID | 1443 |
UniProt ID | B1A4H9 |
Refseq Size | 598 |
Cytogenetics | 17q23.3 |
Refseq ORF | 366 |
Synonyms | CS-2; CSB; GHB1; hCS-B; PL |
Summary | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411617 | CSH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411617 | Transient overexpression lysate of chorionic somatomammotropin hormone 2 (CSH2), transcript variant 2 |
CNY 3,080.00 |
|
PH323392 | CSH2 MS Standard C13 and N15-labeled recombinant protein (NP_072171) |
CNY 19,520.00 |
|
TP761208 | Purified recombinant protein of Human chorionic somatomammotropin hormone 2 (CSH2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Placental lactogen产品