TRF2 (TERF2) (NM_005652) Human Recombinant Protein
CAT#: TP323601
Recombinant protein of human telomeric repeat binding factor 2 (TERF2), 20 µg
View other "TRF2" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223601 representing NM_005652
Red=Cloning site Green=Tags(s) MAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRG SRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIK TEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQ NFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPP TTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSEL QPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEK ETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDR WRTMKRLGMN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005643 |
Locus ID | 7014 |
UniProt ID | Q15554 |
Refseq Size | 2909 |
Cytogenetics | 16q22.1 |
Refseq ORF | 1500 |
Synonyms | TRBF2; TRF2 |
Summary | This gene encodes a telomere specific protein, TERF2, which is a component of the telomere nucleoprotein complex. This protein is present at telomeres in metaphase of the cell cycle, is a second negative regulator of telomere length and plays a key role in the protective activity of telomeres. While having similar telomere binding activity and domain organization, TERF2 differs from TERF1 in that its N terminus is basic rather than acidic. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
PRL-3 promotes telomere deprotection and chromosomal instability
,Lian, S;Meng, L;Yang, Y;Ma, T;Xing, X;Feng, Q;Song, Q;Liu, C;Tian, Z;Qu, L;Shou, C;,
Nucleic Acids Res.
,PubMed ID 28482095
[TRF2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH323601 | TERF2 MS Standard C13 and N15-labeled recombinant protein (NP_005643) |
CNY 19,520.00 |