Casein (CSN1S1) (NM_001890) Human Recombinant Protein
CAT#: TP323721
Recombinant protein of human casein alpha s1 (CSN1S1), transcript variant 1, 20 µg
View other "Casein" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223721 protein sequence
Red=Cloning site Green=Tags(s) MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNE STQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLN QLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001881 |
Locus ID | 1446 |
UniProt ID | P47710 |
Refseq Size | 981 |
Cytogenetics | 4q13.3 |
Refseq ORF | 555 |
Synonyms | CASA; CSN1 |
Summary | Important role in the capacity of milk to transport calcium phosphate.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419687 | CSN1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422589 | CSN1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419687 | Transient overexpression lysate of casein alpha s1 (CSN1S1), transcript variant 1 |
CNY 3,080.00 |
|
LY422589 | Transient overexpression lysate of casein alpha s1 (CSN1S1), transcript variant 2 |
CNY 3,080.00 |
|
PH323721 | CSN1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001881) |
CNY 19,520.00 |