SMAP1 (NM_021940) Human Recombinant Protein
CAT#: TP324031
Recombinant protein of human small ArfGAP 1 (SMAP1), transcript variant 2, 20 µg
View other "SMAP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224031 representing NM_021940
Red=Cloning site Green=Tags(s) MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRV KSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKE KEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVP PLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILS LYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFM GNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQMNQQMAGMSISSATPTAGFGQPSS TTAGWSGSSSGQTLSTQLWK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068759 |
Locus ID | 60682 |
UniProt ID | Q8IYB5 |
Refseq Size | 3268 |
Cytogenetics | 6q13 |
Refseq ORF | 1320 |
Synonyms | SMAP-1 |
Summary | The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411872 | SMAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420821 | SMAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411872 | Transient overexpression lysate of small ArfGAP 1 (SMAP1), transcript variant 2 |
CNY 4,840.00 |
|
LY420821 | Transient overexpression lysate of small ArfGAP 1 (SMAP1), transcript variant 1 |
CNY 3,080.00 |
|
PH306367 | SMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001037770) |
CNY 19,520.00 |
|
PH324031 | SMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_068759) |
CNY 19,520.00 |
|
TP306367 | Recombinant protein of human small ArfGAP 1 (SMAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |