CARS1 (NM_139273) Human Recombinant Protein
CAT#: TP324149
Recombinant protein of human cysteinyl-tRNA synthetase (CARS), transcript variant 1, 20 µg
View other "CARS1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224149 representing NM_139273
Red=Cloning site Green=Tags(s) MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHMGHARS YISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRPEAAQLLEDVQAALKPFSVKL NETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNS IFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFASSEK HSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSA MAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDA LKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAEL NKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGA VEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNILPELGVRFE DHEGLPTVVKLVDRNTLLKEREEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSK FDENVSMVCPHMTWRAKSSAKGKPRS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 82.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_644802 |
Locus ID | 833 |
UniProt ID | P49589 |
Refseq Size | 2536 |
Cytogenetics | 11p15.4 |
Refseq ORF | 2178 |
Synonyms | CARS; CYSRS; MCDDBH; MDBH; MGC:11246 |
Summary | This gene encodes a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain on chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Aminoacyl-tRNA biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408331 | CARS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC423062 | CARS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY408331 | Transient overexpression lysate of cysteinyl-tRNA synthetase (CARS), transcript variant 1 |
CNY 4,840.00 |
|
LY423062 | Transient overexpression lysate of cysteinyl-tRNA synthetase (CARS), transcript variant 3 |
CNY 4,840.00 |
|
PH324092 | CARS MS Standard C13 and N15-labeled recombinant protein (NP_001014437) |
CNY 14,250.00 |
|
PH324149 | CARS MS Standard C13 and N15-labeled recombinant protein (NP_644802) |
CNY 19,520.00 |
|
TP324092 | Recombinant protein of human cysteinyl-tRNA synthetase (CARS), transcript variant 3, 20 µg |
CNY 2,900.00 |