PDE9A (NM_001001574) Human Recombinant Protein
CAT#: TP324417
Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 9, 20 µg
View other "PDE9A" proteins (27)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224417 representing NM_001001574
Red=Cloning site Green=Tags(s) MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRTPYKVRPVAIKQLSEREELIQSV LAQVAEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYS FLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLR RWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQIN ARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFK EKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDK VTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATE KSRERSRDVKNSEGDCA TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 58.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001001574 |
Locus ID | 5152 |
UniProt ID | O76083 |
Refseq Size | 1845 |
Cytogenetics | 21q22.3 |
Refseq ORF | 1521 |
Synonyms | HSPDE9A2 |
Summary | The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419224 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424385 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424386 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424388 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424391 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424392 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424393 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424394 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424395 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424399 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424400 | PDE9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY419224 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 1 |
CNY 4,840.00 |
|
LY424385 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 3 |
CNY 4,840.00 |
|
LY424386 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 4 |
CNY 4,840.00 |
|
LY424388 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 6 |
CNY 4,840.00 |
|
LY424391 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 9 |
CNY 4,840.00 |
|
LY424392 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 10 |
CNY 4,840.00 |
|
LY424393 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 11 |
CNY 3,080.00 |
|
LY424394 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 12 |
CNY 4,840.00 |
|
LY424395 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 13 |
CNY 4,840.00 |
|
LY424399 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 17 |
CNY 4,840.00 |
|
LY424400 | Transient overexpression lysate of phosphodiesterase 9A (PDE9A), transcript variant 18 |
CNY 4,840.00 |
|
PH317127 | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001578) |
CNY 14,250.00 |
|
PH324133 | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001568) |
CNY 14,250.00 |
|
PH324417 | PDE9A MS Standard C13 and N15-labeled recombinant protein (NP_001001574) |
CNY 14,250.00 |
|
TP317127 | Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 13, 20 µg |
CNY 2,900.00 |
|
TP324133 | Purified recombinant protein of Homo sapiens phosphodiesterase 9A (PDE9A), transcript variant 3, 20 µg |
CNY 2,900.00 |