POLR2J2 (NM_032959) Human Recombinant Protein
CAT#: TP324755
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), 20 µg
View other "POLR2J2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224755 representing NM_032959
Red=Cloning site Green=Tags(s) MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116581 |
Locus ID | 246721 |
UniProt ID | Q9GZM3 |
Refseq Size | 1727 |
Cytogenetics | 7q22.1 |
Refseq ORF | 345 |
Synonyms | HRPB11B; POLR2J3; RPB11b1; RPB11b2 |
Summary | This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409843 | POLR2J2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409843 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) |
CNY 3,080.00 |
|
PH324755 | POLR2J2 MS Standard C13 and N15-labeled recombinant protein (NP_116581) |
CNY 19,520.00 |
|
TP760696 | Purified recombinant protein of Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它POLR2J2产品