Neurogranin (NRGN) (NM_001126181) Human Recombinant Protein
CAT#: TP324996
Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2, 20 µg
View other "Neurogranin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224996 protein sequence
Red=Cloning site Green=Tags(s) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG AGGGPSGD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001119653 |
Locus ID | 4900 |
UniProt ID | Q92686, A0A024R3M7 |
Refseq Size | 1238 |
Cytogenetics | 11q24.2 |
Refseq ORF | 234 |
Synonyms | hng; RC3 |
Summary | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416815 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426667 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416815 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 |
CNY 3,080.00 |
|
LY426667 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2 |
CNY 3,080.00 |
|
PH301209 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167) |
CNY 19,520.00 |
|
PH324996 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_001119653) |
CNY 19,520.00 |
|
TP301209 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Neurogranin产品