Glutaredoxin 1 (GLRX) (NM_001118890) Human Recombinant Protein
CAT#: TP325029L
Recombinant protein of human glutaredoxin (thioltransferase) (GLRX), transcript variant 2, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225029 protein sequence
Red=Cloning site Green=Tags(s) MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001112362 |
Locus ID | 2745 |
UniProt ID | P35754, A0A024RAM2 |
Refseq Size | 1093 |
Cytogenetics | 5q15 |
Refseq ORF | 318 |
Synonyms | GRX; GRX1 |
Summary | This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
其它Glutaredoxin 1产品