HCCS (NM_001122608) Human Recombinant Protein
CAT#: TP325362
Recombinant protein of human holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), 20 µg
View other "HCCS" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225362 representing NM_001122608
Red=Cloning site Green=Tags(s) MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRG TAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDE DISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDR HDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116080 |
Locus ID | 3052 |
UniProt ID | P53701, A0A024RBY9 |
Cytogenetics | Xp22.2 |
Refseq ORF | 804 |
Synonyms | CCHL; LSDMCA1; MCOPS7; MLS |
Summary | The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010] |
Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426535 | HCCS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY426535 | Transient overexpression lysate of holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), transcript variant 2 |
CNY 3,080.00 |
|
PH325362 | HCCS MS Standard C13 and N15-labeled recombinant protein (NP_001116080) |
CNY 19,520.00 |