Dermokine (DMKN) (NM_001126056) Human Recombinant Protein
CAT#: TP325655
Recombinant protein of human dermokine (DMKN), transcript variant 3, 20 µg
View other "Dermokine" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225655 representing NM_001126056
Red=Cloning site Green=Tags(s) MKFQGPLACLLLALCLGSGEAGPLQSGEESTGTNIGEALGHGLGDALSEGVGKAIGKEAGGAAGSKVSEA LGQGTREAVGTGVRQVPGFGVADALGNRVGEAAHALGNTGHEIGRQAEDVIRHGADAVRGSWQGVPGHNG AWETSGGHGIFGSQGGLGGQGQGNPGGLGTPWVHGYPGNSAGSFGMNPQGAPWGQGGNGGPPNFGTNTQG AVAQPGYGSVRASNQNEGCTNPPPSGSGGGSSNSGGSSTGSSSGNHGGSGGGNGHKPGCEKPGNEARGSG ESGIQGFRGQGVSSNMREISKEGNRLLGGSGDNYRGQGSSWGSGGGDAVGGVNTVNSETSPGMFNFDTFW KNFKSKLGFINWDAINKNQVPPPSTRALLYFSRLWEDFKQNTPFLNWKAIIEGA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001119528 |
Locus ID | 93099 |
UniProt ID | Q6E0U4 |
Cytogenetics | 19q13.12 |
Refseq ORF | 1130 |
Synonyms | UNQ729; ZD52F10 |
Summary | This gene is upregulated in inflammatory diseases, and it was first observed as expressed in the differentiated layers of skin. The most interesting aspect of this gene is the differential use of promoters and terminators to generate isoforms with unique cellular distributions and domain components. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2010] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Matrix Metalloproteinase 10 Degradomics in Keratinocytes and Epidermal Tissue Identifies Bioactive Substrates With Pleiotropic Functions *
,null,
Molecular & Cellular Proteomics : MCP
,PubMed ID 26475864
[DMKN]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426636 | DMKN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434240 | DMKN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY426636 | Transient overexpression lysate of dermokine (DMKN), transcript variant 3 |
CNY 3,080.00 |
|
LY434240 | Transient overexpression lysate of dermokine (DMKN), transcript variant 8 |
CNY 3,080.00 |
|
PH325655 | DMKN MS Standard C13 and N15-labeled recombinant protein (NP_001119528) |
CNY 19,520.00 |
其它Dermokine产品