LRRFIP2 (NM_001134369) Human Recombinant Protein
CAT#: TP325687
Purified recombinant protein of Homo sapiens leucine rich repeat (in FLII) interacting protein 2 (LRRFIP2), transcript variant 3, 20 µg
View other "LRRFIP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225687 representing NM_001134369
Red=Cloning site Green=Tags(s) MGTPASGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQKELDEKSDKQYAE NYTRPSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELRDIYDLKDQIQDVEGRYMQGLKELKESL SEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKM EELKEGLRQRDELIEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEK EELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLSKAEQDITTL EQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEKMKANRTAL LAQQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001127841 |
Locus ID | 9209 |
UniProt ID | Q9Y608, A8K649 |
Cytogenetics | 3p22.2 |
Refseq ORF | 1272 |
Synonyms | HUFI-2 |
Summary | The protein encoded by this gene, along with MYD88, binds to the cytosolic tail of toll-like receptor 4 (TLR4), which results in activation of nuclear factor kappa B signaling. The ubiquitin-like protein FAT10 prevents the interaction of the encoded protein and TLR4, thereby inactivating the nuclear factor kappa B signaling pathway. In addition, this protein can downregulate the NLRP3 inflammasome by recruiting the caspase-1 inhibitor Flightless-I to the inflammasome complex. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427402 | LRRFIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427402 | Transient overexpression lysate of leucine rich repeat (in FLII) interacting protein 2 (LRRFIP2), transcript variant 3 |
CNY 3,080.00 |
|
PH325687 | LRRFIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001127841) |
CNY 14,250.00 |
其它LRRFIP2产品