United States
Germany
Japan
United Kingdom
China
Chk1 (CHEK1) (NM_001114122) Human Recombinant Protein
CAT＃: TP325807
Purified recombinant protein of Homo sapiens CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 3, 20 µg
View other "Chk1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225807 protein sequence
Red=Cloning site Green=Tags(s) MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKF YGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDE RDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQ PSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTS GGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP DHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001107594 |
| Locus ID | 1111 |
| UniProt ID | O14757 |
| Refseq Size | 4174 |
| Cytogenetics | 11q24.2 |
| Refseq ORF | 1428 |
| Synonyms | CHK1 |
| Summary | The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Protein Kinase, Stem cell - Pluripotency |
| Protein Pathways | Cell cycle, p53 signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400510 | CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426457 | CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426458 | CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400510 | Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 1 |
CNY 3,080.00 |
|
| LY426457 | Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 2 |
CNY 3,080.00 |
|
| LY426458 | Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 3 |
CNY 3,080.00 |
|
| PH325807 | CHEK1 MS Standard C13 and N15-labeled recombinant protein (NP_001107594) |
CNY 14,250.00 |
|
| TP762547 | Purified recombinant protein of Human CHK1 checkpoint homolog (S.pombe) (CHEK1), transcript variant 1, 50ug |
CNY 2,480.00 |
