NT5C2 (NM_001134373) Human Recombinant Protein
CAT#: TP325961
Recombinant protein of human 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 2, 20 µg
View other "NT5C2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225961 protein sequence
Red=Cloning site Green=Tags(s) MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGF ELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNK FIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHY KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQ SYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIG DHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTV EHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEE E myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 64.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001127845 |
Locus ID | 22978 |
UniProt ID | P49902, A0A384MED8, A8K6K2 |
Refseq Size | 3453 |
Cytogenetics | 10q24.32-q24.33 |
Refseq ORF | 1686 |
Synonyms | cN-II; GMP; NT5B; PNT5; SPG45; SPG65 |
Summary | This gene encodes a hydrolase that serves as an important role in cellular purine metabolism by acting primarily on inosine 5'-monophosphate and other purine nucleotides. [provided by RefSeq, Oct 2011] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415891 | NT5C2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427403 | NT5C2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415891 | Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1 |
CNY 3,080.00 |
|
LY427403 | Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 2 |
CNY 3,080.00 |
|
PH300194 | NT5C2 MS Standard C13 and N15-labeled recombinant protein (NP_036361) |
CNY 19,520.00 |
|
PH325961 | NT5C2 MS Standard C13 and N15-labeled recombinant protein (NP_001127845) |
CNY 19,520.00 |
|
TP300194 | Recombinant protein of human 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1, 20 µg |
CNY 2,900.00 |