CD18 (ITGB2) (NM_001127491) Human Recombinant Protein
CAT#: TP326157
Purified recombinant protein of Homo sapiens integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) (ITGB2), transcript variant 2, 20 µg
View other "CD18" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226157 representing NM_001127491
Red=Cloning site Green=Tags(s) MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLM RGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML DDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKL TNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILT PNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSS NVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSS QELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCG KCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAE CLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN IAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 82.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Far-Western blot (PMID: 26600301) ELISA binding assay (PMID: 29125705) |
Reference Data | |
RefSeq | NP_001120963 |
Locus ID | 3689 |
UniProt ID | P05107, A0A494C0X7 |
Cytogenetics | 21q22.3 |
Refseq ORF | 2307 |
Synonyms | CD18; LAD; LCAMB; LFA-1; MAC-1; MF17; MFI7 |
Summary | This gene encodes an integrin beta chain, which combines with multiple different alpha chains to form different integrin heterodimers. Integrins are integral cell-surface proteins that participate in cell adhesion as well as cell-surface mediated signalling. The encoded protein plays an important role in immune response and defects in this gene cause leukocyte adhesion deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, Viral myocarditis |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Mycobacterium tuberculosis Mce3C promotes mycobacteria entry into macrophages through activation of β2 integrin-mediated signalling pathway
,Zhang, Y;Li, J;Li, B;Wang, J;Liu, CH;,
Cell. Microbiol.2017
,PubMed ID 29125705
[ITGB2]
|
Mutually Exclusive Roles of SHARPIN in Integrin Inactivation and NF-?B Signaling
,De Franceschi, N;Peuhu, E;Parsons, M;Rissanen, S;Vattulainen, I;Salmi, M;Ivaska, J;Pouwels, J;,
PLoS ONE
,PubMed ID 26600301
[ITGB2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400076 | ITGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426800 | ITGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400076 | Transient overexpression lysate of integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) (ITGB2), transcript variant 1 |
CNY 3,080.00 |
|
LY426800 | Transient overexpression lysate of integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) (ITGB2), transcript variant 2 |
CNY 4,840.00 |
|
PH326157 | ITGB2 MS Standard C13 and N15-labeled recombinant protein (NP_001120963) |
CNY 14,250.00 |