United States
Germany
Japan
United Kingdom
China
NONO (NM_001145408) Human Recombinant Protein
CAT＃: TP326567
Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 1, 20 µg
View other "NONO" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 2 publications. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226567 protein sequence
Red=Cloning site Green=Tags(s) MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001138880 |
| Locus ID | 4841 |
| UniProt ID | Q15233 |
| Refseq Size | 3228 |
| Cytogenetics | Xq13.1 |
| Refseq ORF | 1413 |
| Synonyms | MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114 |
| Summary | This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009] |
| Protein Families | Druggable Genome, Transcription Factors |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The caspase-2 substrate p54nrb exhibits a multifaceted role in tumor cell death susceptibility via gene regulatory functions
,null,
Cell Death & Disease
,PubMed ID 35444189
[NONO]
|
|
IGFBP-3 interacts with NONO and SFPQ in PARP-dependent DNA damage repair in triple-negative breast cancer
,de Silva, HC;Lin, MZ;Phillips, L;Martin, JL;Baxter, RC;,
Cell. Mol. Life Sci.
,PubMed ID 30725116
[NONO]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402135 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428867 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428868 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428869 | NONO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402135 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 2 |
CNY 3,080.00 |
|
| LY428867 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 1 |
CNY 3,080.00 |
|
| LY428868 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 3 |
CNY 3,080.00 |
|
| LY428869 | Transient overexpression lysate of non-POU domain containing, octamer-binding (NONO), transcript variant 4 |
CNY 3,080.00 |
|
| PH306688 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_031389) |
CNY 19,520.00 |
|
| PH326567 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138880) |
CNY 19,520.00 |
|
| PH326579 | NONO MS Standard C13 and N15-labeled recombinant protein (NP_001138881) |
CNY 19,520.00 |
|
| TP306688 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326579 | Recombinant protein of human non-POU domain containing, octamer-binding (NONO), transcript variant 3, 20 µg |
CNY 2,900.00 |
