United States
Germany
Japan
United Kingdom
China
Parvin gamma (PARVG) (NM_001137606) Human Recombinant Protein
CAT＃: TP327051
Recombinant protein of human parvin, gamma (PARVG), transcript variant 3, 20 µg
View other "Parvin gamma" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227051 protein sequence
Red=Cloning site Green=Tags(s) MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEE DMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTL HLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVN AVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALE LLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001131078 |
| Locus ID | 64098 |
| UniProt ID | Q9HBI0 |
| Refseq Size | 1991 |
| Cytogenetics | 22q13.31 |
| Refseq ORF | 993 |
| Synonyms | AI413459; gamma-parvin; OTTMUSP00000032048; parvin, gamma |
| Summary | Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM, Aug 2004] |
| Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411746 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427944 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427945 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411746 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 1 |
CNY 3,080.00 |
|
| LY427944 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 2 |
CNY 3,080.00 |
|
| LY427945 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 3 |
CNY 3,080.00 |
|
| PH306755 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_071424) |
CNY 19,520.00 |
|
| PH326988 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131077) |
CNY 19,520.00 |
|
| PH327051 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131078) |
CNY 19,520.00 |
|
| TP306755 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326988 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Parvin gamma产品
