Myosin Phosphatase (PPP1R12A) (NM_001143885) Human Recombinant Protein
CAT#: TP327493
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 2, 20 µg
View other "Myosin Phosphatase" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227493 representing NM_001143885
Red=Cloning site Green=Tags(s) MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYAN VDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGD TPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKG YTEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYL EELQKKQNLLHSEKRDKKSPLIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKK DESSCSSEEDEEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSLDNKEKEKDSK GTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKNSSVNEGSTYHKSCSFGRRQD DLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGSSSAGTQSSTSNRLWAEDSTEKEKDSVPTAV TIPVAPTVVNAAASTTTLTTTTAGTVSSTTEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVT LTDLQEAEKTIGRSRSTRTREQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYR PVSTSSSTTPSSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSI RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGS YSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSLL EMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGALIRVISKLSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 115.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001137357 |
Locus ID | 4659 |
UniProt ID | O14974 |
Cytogenetics | 12q21.2-q21.31 |
Refseq ORF | 3090 |
Synonyms | GUBS; M130; MBS; MYPT1 |
Summary | Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase. Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho. The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells. The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP.RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC. Rho-associated kinase (Rho-kinase), which is activated by GTP. RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase. Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC. Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Focal adhesion, Long-term potentiation, Regulation of actin cytoskeleton, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400883 | PPP1R12A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428392 | PPP1R12A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400883 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 1 |
CNY 4,840.00 |
|
LY428392 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 2 |
CNY 4,840.00 |
|
PH323540 | PPP1R12A MS Standard C13 and N15-labeled recombinant protein (NP_002471) |
CNY 19,520.00 |
|
PH327493 | PPP1R12A MS Standard C13 and N15-labeled recombinant protein (NP_001137357) |
CNY 19,520.00 |
|
TP323540 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 12A (PPP1R12A), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Myosin Phosphatase产品