DACH2 (NM_001139515) Human Recombinant Protein
CAT#: TP327811
Recombinant protein of human dachshund homolog 2 (Drosophila) (DACH2), transcript variant 3, 20 µg
View other "DACH2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227811 representing NM_001139515
Red=Cloning site Green=Tags(s) MTRKQAVNSSRPGRPPKRSLGVLQENARLLTHAVPGLLSPGLITPTGITAAAMAEAMKLQKMKLMAMNTL QGNGSQNGTESEPDDLNSNTGGSESSWDKDKMQSPFAAPGPQHGIAHAALAGQPGIGGAPTLNPLQQNHL LTNRLDLPFMMMPHPLLPVSLPPASVAMAMNQMNHLNTIANMAAAAQIHSPLSRAGTSVIKERIPESPSP APSLEENHRPGSQTSSHTSSSVSSSPSQMDHHLERMEEVPVQIPIMKSPLDKIQLTPGQALPAGFPGPFI FADSLSSVETLLTNIQGLLKVALDNARIQEKQIQQEKKELRLELYREREIRENLERQLAVELQSRTTMQK RLKKEKKTKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNY YCLEMAQQLYSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001132987 |
Locus ID | 117154 |
UniProt ID | Q96NX9 |
Cytogenetics | Xq21.2 |
Refseq ORF | 1296 |
Summary | This gene is one of two genes which encode a protein similar to the Drosophila protein dachshund, a transcription factor involved in cell fate determination in the eye, limb and genital disc of the fly. The encoded protein contains two characteristic dachshund domains: an N-terminal domain responsible for DNA binding and a C-terminal domain responsible for protein-protein interactions. This gene is located on the X chromosome and is subject to inactivation by DNA methylation. The encoded protein may be involved in regulation of organogenesis and myogenesis, and may play a role in premature ovarian failure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409299 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC427975 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427976 | DACH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409299 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 1 |
CNY 4,840.00 |
|
LY427975 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 2 |
CNY 3,080.00 |
|
LY427976 | Transient overexpression lysate of dachshund homolog 2 (Drosophila) (DACH2), transcript variant 3 |
CNY 3,080.00 |
|
PH327811 | DACH2 MS Standard C13 and N15-labeled recombinant protein (NP_001132987) |
CNY 19,520.00 |