Apoptosis inhibitor 5 (API5) (NM_001142931) Human Recombinant Protein
CAT#: TP327863
Recombinant protein of human apoptosis inhibitor 5 (API5), transcript variant 3, 20 µg
View other "Apoptosis inhibitor 5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227863 representing NM_001142931
Red=Cloning site Green=Tags(s) MPTVEELYRNYGILADATEQVGQIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVNNALLSI FKMDAKGTLGGLFSQILQGEDIVRERAIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTGEEFVLF MKILSGLKSLQTVSGRQQLVELVAEQADLEQTFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCE QVLPNLGTLTTPVEGLDIQLEVLKLLAEMSSFCGDMEKLETNLRKLFDKLLEYMPLPPEEAENGENAGNE EPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKTGEALK TEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPK RDARQIYNPPSGKYSSNLGNFNYERSLQGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001136403 |
Locus ID | 8539 |
UniProt ID | Q9BZZ5 |
Cytogenetics | 11p12 |
Refseq ORF | 1350 |
Synonyms | AAC-11; AAC11 |
Summary | This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nuclear factor involved in apoptotic DNA fragmentation. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428299 | API5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY428299 | Transient overexpression lysate of apoptosis inhibitor 5 (API5), transcript variant 3 |
CNY 3,080.00 |
|
PH327863 | API5 MS Standard C13 and N15-labeled recombinant protein (NP_001136403) |
CNY 19,520.00 |
其它Apoptosis inhibitor 5产品