TCP1 eta (CCT7) (NM_001166284) Human Recombinant Protein
CAT#: TP328371
Purified recombinant protein of Homo sapiens chaperonin containing TCP1, subunit 7 (eta) (CCT7), transcript variant 3, 20 µg
View other "TCP1 eta" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228371 representing NM_001166284
Red=Cloning site Green=Tags(s) MMVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEK CAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEM QPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGD VATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKA KTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGA YAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAAS EAACLIVSVDETIKNPRSTVDAPTAAGRGRGRGRPH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001159756 |
Locus ID | 10574 |
UniProt ID | Q99832 |
Cytogenetics | 2p13.2 |
Refseq ORF | 1368 |
Synonyms | CCTETA; CCTH; NIP7-1; TCP1ETA |
Summary | This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 5 and 6. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416654 | CCT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422918 | CCT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431399 | CCT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416654 | Transient overexpression lysate of chaperonin containing TCP1, subunit 7 (eta) (CCT7), transcript variant 1 |
CNY 3,080.00 |
|
LY422918 | Transient overexpression lysate of chaperonin containing TCP1, subunit 7 (eta) (CCT7), transcript variant 2 |
CNY 3,080.00 |
|
LY431399 | Transient overexpression lysate of chaperonin containing TCP1, subunit 7 (eta) (CCT7), transcript variant 3 |
CNY 3,080.00 |
其它TCP1 eta产品