MGMT (NM_002412) Human Recombinant Protein
CAT#: TP329131
Recombinant protein of human O-6-methylguanine-DNA methyltransferase (MGMT), 20 µg
View other "MGMT" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 2,700.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229131 representing NM_002412
Red=Cloning site Green=Tags(s) MLGQPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTS AADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFG EVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP GLGGSSGLAGAWLKGAGATSGSPPAGRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002403 |
Locus ID | 4255 |
UniProt ID | P16455 |
Cytogenetics | 10q26.3 |
Refseq ORF | 714 |
Summary | Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC432155 | MGMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY432155 | Transient overexpression lysate of O-6-methylguanine-DNA methyltransferase (MGMT) |
CNY 3,080.00 |
|
TP721020 | Purified recombinant protein of Human O-6-methylguanine-DNA methyltransferase (MGMT) |
CNY 3,140.00 |
|
TP760054 | Recombinant protein of human O-6-methylguanine-DNA methyltransferase (MGMT), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |