CHMP5 (NM_001195536) Human Recombinant Protein
CAT#: TP331013
Purified recombinant protein of Homo sapiens chromatin modifying protein 5 (CHMP5), transcript variant 2, 20 µg
View other "CHMP5" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC231013 representing NM_001195536
Red=Cloning site Green=Tags(s) MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLK QKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMME DANEIQEALSRSYGTPELDEDDLEAGWSSGG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001182465 |
Locus ID | 51510 |
UniProt ID | Q9NZZ3 |
Cytogenetics | 9p13.3 |
Refseq ORF | 513 |
Synonyms | C9orf83; CGI-34; HSPC177; PNAS-2; SNF7DC2; Vps60 |
Summary | CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414005 | CHMP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434012 | CHMP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414005 | Transient overexpression lysate of chromatin modifying protein 5 (CHMP5) |
CNY 3,080.00 |
|
LY434012 | Transient overexpression lysate of chromatin modifying protein 5 (CHMP5), transcript variant 2 |
CNY 3,080.00 |