Dpy30 (NM_001146224) Mouse Recombinant Protein

CAT#: TP500297

Purified recombinant protein of Mouse dpy-30, histone methyltransferase complex regulatory subunit (Dpy30), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200297 protein sequence
Red=Cloning site Green=Tags(s)

MESEQMLEGQTQVAENPHSEYGLTDSVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLA
VLAKERPPNPIEFLASYLLKNKAQFEDRN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 11.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001139696
Locus ID 66310
UniProt ID Q99LT0
Refseq Size 710
Cytogenetics 17 E2
Refseq ORF 300
Synonyms 2810410M20Rik; C87842
Summary As part of the MLL1/MLL complex, involved in the methylation of histone H3 at 'Lys-4', particularly trimethylation. Histone H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. May play some role in histone H3 acetylation. In embryonic stem (ES) cells, plays a crucial role in the differentiation potential, particularly along the neural lineage, regulating gene induction and histone H3 'Lys-4' methylation at key developmental loci, including that mediated by retinoic acid. Does not affect ES cell self-renewal. May also play an indirect or direct role in endosomal transport.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...