Aamdc (NM_183251) Mouse Recombinant Protein
CAT#: TP500612
Purified recombinant protein of Mouse adipogenesis associated Mth938 domain containing (Aamdc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200612 protein sequence
Red=Cloning site Green=Tags(s) MASPKIASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVKEVAEKGVQTLVIGRG MSEALKVPPSTVEYLEKQGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 13.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_899074 |
Locus ID | 66273 |
UniProt ID | Q8R0P4 |
Refseq Size | 789 |
Cytogenetics | 7 E1 |
Refseq ORF | 369 |
Synonyms | 1810020D17Rik; 1810037D19Rik; LI2 |
Summary | May play a role in preadipocyte differentiation and adipogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |