Polr1d (NM_181730) Mouse Recombinant Protein
CAT#: TP500671
Purified recombinant protein of Mouse polymerase (RNA) I polypeptide D (Polr1d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200671 protein sequence
Red=Cloning site Green=Tags(s) MEDDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLAGTNKRFLINTIKNTLPSHKEQDHEQKEGSK EPGKSQDQKEASGKKYRSHSYKRSLHSSRGSAGCSPPRKRTSRTSGDKCDPRPSRR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 14.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_859419 |
Locus ID | 20018 |
UniProt ID | Q9D1M1 |
Refseq Size | 1147 |
Cytogenetics | 5 G3 |
Refseq ORF | 381 |
Synonyms | 16kD; 1110003G10Rik; AC19; mRP; RPA16; Rpo; Rpo1-3 |
Summary | This gene encodes an RNA polymerase subunit that is a component of both the RNA polymerase I and RNA polymerase III complexes. RNA polymerase I is associated with transcription of pre-ribosomal RNAs, while RNA polymerase III is associated with transcription of small RNAs. Pseudogenes of this gene have been defined on chromosomes 4 and 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013] |
Documents
FAQs |
SDS |