4833442J19Rik (BC046911) Mouse Recombinant Protein
CAT#: TP500705
Purified recombinant protein of Mouse RIKEN cDNA 4833442J19 gene (cDNA clone MGC:57103 IMAGE:6491688), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200705 protein sequence
Red=Cloning site Green=Tags(s) MSGASKILANDIDPIAGMAITLNCKLNGLNPFPVLTKNILNTQQGKFDLIVLGDMFYDEDLADSLHLWLQ NYFWTHGTRVLIGDPGRPQFSGHSIRHQLYQLVEYTLPEPTQQENNGLTTSAVWDFHP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 14.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 320204 |
UniProt ID | Q80ZM3 |
Refseq Size | 1104 |
Cytogenetics | 6 G3 |
Refseq ORF | 384 |
Synonyms | 4833442J19Rik; AI256744; ETFB-KMT |
Summary | Protein-lysine methyltransferase that selectively trimethylates the flavoprotein ETFB in mitochondria. Thereby, may negatively regulate the function of ETFB in electron transfer from Acyl-CoA dehydrogenases.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它4833442J19Rik产品