Lsm1 (NM_026032) Mouse Recombinant Protein
CAT#: TP500775
Purified recombinant protein of Mouse LSM1 homologdegradation associated (Lsm1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200775 protein sequence
Red=Cloning site Green=Tags(s) MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN VVLLGEIDLEKESDTPLQQVSIEEILEEQRVQQQTRLEAEKLKVQTLKDRGLSIPRADTLDEY myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080308 |
Locus ID | 67207 |
UniProt ID | Q8VC85 |
Refseq Size | 2360 |
Cytogenetics | 8 A2 |
Refseq ORF | 402 |
Synonyms | 2810025O06Rik; CASM |
Summary | Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated (By similarity). Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |