Grp (NM_175012) Mouse Recombinant Protein
CAT#: TP500979
Purified recombinant protein of Mouse gastrin releasing peptide (Grp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200979 protein sequence
Red=Cloning site Green=Tags(s) MRGSELSLLLLALVLCQAPRGPAAPVSTGAGGGTVLAKMYPRGSHWAVGHLMGKKSTDESPSLYAADRDG LKEQLRGYVRWEEAARDLLDLLEAAGNQSHQPPQHPPLSLQPTWDPEDGSYFNDVQTAKLVDSLLQVLKE KGGTAS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_778177 |
Locus ID | 225642 |
UniProt ID | Q8R1I2 |
Refseq Size | 912 |
Cytogenetics | 18 38.98 cM |
Refseq ORF | 441 |
Synonyms | B; BLP |
Summary | This gene encodes a neuropeptide hormone that affects various biological processes such as neuroendocrine regulation, gastrointestinal secretion, nociception, cell proliferation and inflammation. The encoded protein undergoes proteolytic processing to generate multiple mature peptides with biological activity. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |