Mal (NM_010762) Mouse Recombinant Protein
CAT#: TP501113
Purified recombinant protein of Mouse myelin and lymphocyte protein, T cell differentiation protein (Mal), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201113 protein sequence
Red=Cloning site Green=Tags(s) MAPAAASGGSTLPSGFSVFTTFPDLLFVCEFVFGGLVWILIASSLVPLPLAQGWVMFVSVFCFVATTSLM ILYIIGTHGGETSWITLDAAYHCVAALFYLSASVLEALATISMFDGFTYKHYHENIAAVVFAYVVTLIYV VHAVFSLIRWKSS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034892 |
Locus ID | 17153 |
UniProt ID | O09198 |
Refseq Size | 2792 |
Cytogenetics | 2 F1 |
Refseq ORF | 462 |
Synonyms | Mpv17; VI; Vip17 |
Summary | This gene encodes a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The encoded protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010] |
Documents
FAQs |
SDS |