Fam96a (NM_026635) Mouse Recombinant Protein
CAT#: TP501241
Purified recombinant protein of Mouse cytosolic iron-sulfur assembly component 2A (Ciao2a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201241 protein sequence
Red=Cloning site Green=Tags(s) MERVSGLLSWTLSRVLWLSGFSEHGAAWQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVTESCVEVQ EINEDDYLVIIKFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVA AAMENPNLREIVEQCVLEPD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 18.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080911 |
Locus ID | 68250 |
UniProt ID | Q9DCL2 |
Refseq Size | 1253 |
Cytogenetics | 9 C |
Refseq ORF | 483 |
Synonyms | 5730536A07Rik |
Summary | Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:23891004). As a CIA complex component and in collaboration with CIAO1 specifically matures ACO1 and stabilizes IREB2 (PubMed:23891004). May play a role in chromosome segregation through establishment of sister chromatid cohesion. May induce apoptosis in collaboration with APAF1 (PubMed:25716227).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |