Nudt15 (NM_172527) Mouse Recombinant Protein
CAT#: TP501427
Purified recombinant protein of Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 15 (Nudt15), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
货期*
4周
规格
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201427 protein sequence
Red=Cloning site Green=Tags(s) MAANAEPRRRPGVGVGVVVLSCEHPRCVLLGKRKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLH LKNVCFASVVNSFVEKENYHYVTILMKGEVDMTHDSEPRNMEPEKNESWEWVPWEEFPPLDQLFWALRCL KEQGYDPFKEDLNHLEGYRGEHLERTTKTP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_766115 |
Locus ID | 214254 |
UniProt ID | Q8BG93 |
Refseq Size | 2592 |
Cytogenetics | 14 D3 |
Refseq ORF | 513 |
Synonyms | 6530403O17; A730068G11Rik; MTH2 |
Summary | May catalyze the hydrolysis of nucleoside triphosphates including dGTP, dTTP, dCTP, their oxidized forms like 8-oxo-dGTP and the prodrug thiopurine derivatives 6-thio-dGTP and 6-thio-GTP (PubMed:12767940). Could also catalyze the hydrolysis of some nucleoside diphosphate derivatives (By similarity). Hydrolyzes oxidized nucleosides triphosphates like 8-oxo-dGTP in vitro, but the specificity and efficiency towards these substrates are low. Therefore, the potential in vivo sanitizing role of this enzyme, that would consist in removing oxidatively damaged forms of nucleosides to prevent their incorporation into DNA, is unclear (PubMed:12767940). Through the hydrolysis of thioguanosine triphosphates may participate in the catabolism of thiopurine drugs (By similarity). May also have a role in DNA synthesis and cell cycle progression by stabilizing PCNA (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...