Ppp1r1a (NM_021391) Mouse Recombinant Protein

CAT#: TP501432

Purified recombinant protein of Mouse protein phosphatase 1, regulatory inhibitor subunit 1A (Ppp1r1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Ppp1r1a Antibody - N-terminal region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201432 protein sequence
Red=Cloning site Green=Tags(s)

MEPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNSLLKSTLSMSPRQ
RKKMTRTTPTMKELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPDTGSASRPDTPGTAQKSAESN
PKTQEQCGVEPRTEDSSAHMLPLDSQGASLV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 18.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067366
Locus ID 58200
UniProt ID Q9ERT9
Refseq Size 1295
Cytogenetics 15 F3
Refseq ORF 516
Synonyms 0610038N18Rik; I-1
Summary Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...